PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 889592
Common NameARALYDRAFT_889592
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family Dof
Protein Properties Length: 262aa    MW: 29600.3 Da    PI: 4.4313
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
889592genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof1183.7e-373894561
  zf-Dof  5 alkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkks 61
            a +cprC s+ntkfCyynnyslsqPryfCk+CrryWtkGG+lrn+PvGgg+rk+ +s
  889592 38 APACPRCASSNTKFCYYNNYSLSQPRYFCKGCRRYWTKGGSLRNIPVGGGCRKRSRS 94
            668**************************************************9876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF027011.4E-313993IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.2863993IPR003851Zinc finger, Dof-type
PROSITE patternPS0136104177IPR003851Zinc finger, Dof-type
ProDomPD0074782.0E-254193IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 262 aa     Download sequence    Send to blast
MLPYIGHNSY LQQHQFPSPE MEIPEKWKLS YGQEATTAPA CPRCASSNTK FCYYNNYSLS  60
QPRYFCKGCR RYWTKGGSLR NIPVGGGCRK RSRSRQNSHK RFGRNENRPD GLNNQDDGLQ  120
SSPPGPDIDL AAVFAQYVTD GSPSSTDNTT GSEQDSPITT TTHTLDSLSW DICQETDVDL  180
GFYEEFNNLT KKTEEDQRGF GQLLEDDREE IFEFQGLLDD KEIQEILECS FSEEPDQLIS  240
QGSFMVNGDN WSSTDLTRFG I*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
18994KRSRSR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC0154470.0AC015447.8 Arabidopsis thaliana chromosome I BAC F24J8 genomic sequence, complete sequence.
GenBankCP0026840.0CP002684.1 Arabidopsis thaliana chromosome 1 sequence.
GenBankDQ4462680.0DQ446268.1 Arabidopsis thaliana clone pENTR221-At1g21340 Dof-type zinc finger domain-containing protein (At1g21340) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002890437.10.0Dof-type zinc finger domain-containing protein
SwissprotP683490.0DOF12_ARATH; Dof zinc finger protein DOF1.2
TrEMBLD7KK010.0D7KK01_ARALL; Dof-type zinc finger domain-containing protein
STRINGscaffold_102386.10.0(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM64622643
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G21340.10.0Dof family protein